Mini-Spotlight: LL-37

LL-37 (PLL-4445-s), or Cathelicidin Antimicrobial Peptide, is a 37-amino acid antimicrobial peptide resulting from extracellular cleavage of the C-terminal end of the 18-kDa hCAP18 protein. It causes permeabilization of the microbial membrane, killing bacteria, and is highly expressed during acute inflammation.1

Synonyms/Product Alternate Names: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser, [LL-37, 37 aa], CAP-18, CAP18, LL37

A few newer publications on LL-37:

Cathelicidin is a “fire alarm”, generating protective NLRP3-dependent airway epithelial cell inflammatory responses during infection with Pseudomonas aeruginosa.

Serum concentrations of antimicrobial peptide cathelicidin LL-37 in patients with bacterial lung infections.

Disorder-to-helix conformational conversion of the human immunomodulatory peptide LL-37 induced by anti-inflammatory drugs, food dyes and some metabolites.

Reference:

  1. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2650579/