Liver-Expressed Antimicrobial Peptide 2 (Human) (0.1mg vial)

  • Product Code: PLP-4405-s
  • Synonyms/Product Alternate Names: Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu, LEAP-2 (Human, Mouse), Prepro-LEAP-2 (Human, 38-77), (Mouse 37-76)
  • Antimicrobial Peptide
  • Storage Conditions: -20 °C
  • Molecular Weight: 4581.3
  • Molecular Formula: C191H316N64O57S5
  • Disulfide Bonds: (Disulfide bonds between Cys17-Cys28 and Cys23-Cys33)
  • One-Letter Code:
    MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
  • A. Krause, R. Sillard, B. Kleemeier, E. Klüver, E. Maronde, J.R. Conejo-García, W.G. Forssmann, P. Schulz-Knappe, M.C. Nehls, F. Wattler, S. Wattler, and K. Adermann, Protein Sci., 12, 143 (2003). (Original & S-S Bond)

  • 1ea
  • $279.00