Exendin-4

  • Trifluoroacetate salt
  • Product Code: PEX-3784-PI
  • Synonyms/Product Alternate Names: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2, Exenatide
  • GLP-1 (Glucagon-Like Peptide-1) Receptor Agonist
  • Sequence originally isolated from venom derived from the modified salivary glands of the Gila monster (Heloderma suspectum).

  • Storage Conditions: -20 °C
  • Molecular Weight: 4186.66
  • Molecular Formula: C184H282N50O60S
  • CAS Number: 141758-74-9
  • One-Letter Code:
    H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
  • R Göke, et al., J Biol Chem., 26, 19650 (1993).

  • B. Thorens, et al., Diabetes, 42, 1678, (1993).

  • A. Alcántara, et al., Arch Biochem Biophys., 341, 1, (1997).

  • 1mg
  • $482.00
  • 5mg
  • $1,926.00