APP, A4, AD1 MS Calibrator

  • Product Code: BP22-746-NEP
  • Synonyms/Product Alternate Names: Amyloid beta A4 Protein; ABPP; APPI; Short=APP; Alzheimer Disease Amyloid Protein; Amyloid Precursor Protein; Beta-Amyloid Precursor Protein; Cerebral Vascular Amyloid Peptide; Short=CVAP; PreA4; Protease Nexin-II; Short=PN-II; Contains: N-APP;
  • High quality, quantitated heavy/light peptide calibrator for Mass Spectroscopy research
  • APP, A4, AD1 MS Calibrator: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH

    Gene: APP, A4, AD1

    Amount: 25nmol 

    Protein Name: Amyloid beta A4 Protein; ABPP; APPI; Short=APP; Alzheimer Disease Amyloid Protein; Amyloid Precursor Protein; Beta-Amyloid Precursor Protein; Cerebral Vascular Amyloid Peptide; Short=CVAP; PreA4; Protease Nexin-II; Short=PN-II; Contains: N-APP;

    UniProt ID: P05067

    General TrypTides™ information:

    • C13 and N15 isotope labeled Arg (R^ is +10 amu) and Lys (K^ is +8 amu)
    • >99% Isotopic Enrichment, >95% purity, 25nmols
    • Many of our products are validated by the NCI CPTAC (Clinical Proteomic Tumor Analysis Consortium) program
    • NIST verified Amino Acid Analysis (CV’s < 7.5%)
    • MS data from multiple platforms available for many peptides
    • Customizable sizing, aliquoting, and stability testing

    Upon receipt of your order, NEP will:

    • Verify quantity using AAA to mitigate sample storage and binding issues
    • Verify purity and identity by UPLC/MS to mitigate stability issues
    • Aliquot to your specifications and size (Flexible to your assay!)
    • If a new synthesis is required, please allow 2-3 weeks

    For more information on this product: https://www.newenglandpeptide.com/store/product/app-a4-ad1

  • Storage Conditions: -20 ℃
  • One-Letter Code:
    H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
  • 1ea
  • $299.00
For research use ONLY. Not for use on humans.