West Nile Virus Pre-M Recombinant

  • Product Code: WNV-002
  • West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.

    The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag. 20mM phosphate buffer pH 7.5. Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems. Purified by proprietary chromatographic technique. Immunoreactive with sera of West Nile virus infected individuals.

    Specificity: Immunoreactive with sera of West Nile virus infected individuals.

     

  • Origin: Escherichia Coli
  • Storage Conditions: -20 °C
  • One-Letter Code:
    MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVR YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK ATRYLVKTESWILRNPGYALE
Delivery Details:
Close

All quantities are subject to availability. Please allow 7-10 days for delivery.

  • 100µg
  • $150.00
  • 500µg
  • $600.00
  • 1000µg
  • $1,200.00