Agouti-Related Protein (Human, 86-132) (0.1mg vial)

  • Product Code: PAR-4366-s
  • Synonyms/Product Alternate Names: Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr; AGRP (Human, 86-132)
  • Melanocortin Receptor-3/4 Antagonist; Appetite Boosting Peptide
  • Potent inhibitor of melanocortin receptor function

  • Storage Conditions: -20 °C
  • Molecular Weight: 5347.2
  • Molecular Formula: C223H339N69O63S11
  • Disulfide Bonds: (Disulfide bonds between Cys87-Cys102, Cys94-Cys108, Cys101-Cys119, Cys105-Cys129, and Cys110-Cys117)
  • One-Letter Code:
    RCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
  • R.D. Rosenfeld, L. Zeni, A.A. Welcher, L.O. Narhi, C. Hale, J. Marasco, J. Delaney, T. Gleason, J.S. Philo, V. Katta, J. Hui, H. Baumgartner, M. Graham, K.L. Stark, and W. Karbon, Biochemistry, 37, 16041 (1998). (Original)

  • E.J. Bures, J.O. Hui, Y. Young, D.T. Chow, V. Katta, M.F. Rohde, L. Zeni, R.D. Rosenfeld, K.L. Stark, and M. Haniu, Biochemistry, 37, 12172 (1998). (Structure; S-S Bond)

  • J.R. Shutter, M. Graham, A.C. Kinsey, S. Scully, R. Lüthy, and K.L. Stark, Genes Dev., 11, 593 (1997). (Agouti-Related Transcript Sequence)

  • D.M. Diinulescu and R.D. Con, J. Bio.. Chem., 275, 6695 (2000). (Review).

  • T.R.H. Buch et al., JBC, 284 (39), 26411 (2009).

  • 1ea
  • $386.00