LL-37 ( Human) (0.1mg vial)

  • Product Code: PLL-4445-s
  • Synonyms/Product Alternate Names: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser, CAP-18, CAP18, LL37, LL-37
  • Cathelicidin Antimicrobial Peptide
  • LL-37 is a 37-amino acid peptide resulting from extracellular cleavage of the C-terminal end of the 18-kDa hCAP18 protein.

  • Storage Conditions: -20 °C
  • Purity: ≧98.0% (HPLC)
  • Molecular Weight: 4493.3
  • Molecular Formula: C205H340N60O53
  • CAS Number: 154947-66-7
  • One-Letter Code:
    [LL-37, 37 aa]
  • G.H. Gudmundsson, B. Agerberth, J. Odeberg, T. Bergman, B. Olsson, and R. Salcedo,Eur. J. Biochem., 238, 325 (1996). (Original)

  • R. Bals and J.M. Wilson, Cell. Mol. Life Sci., 60, 711 (2003). (Review)

  • R. Lande, J. Gregorio, V. Facchinetti, B. Chatterjee, Y.-H. Wang, B. Homey, W. Cao, Y.-H. Wang, B. Su, F.O. Nestle, T. Zal, I. Mellman, J.-M. Schröder, Y.-J. Liu, and M. Gilliet, Nature, 449, 564 (2007). (Pharmacol.)

  • M. Zanetti, J. Leukoc. Biol., 75, 39 (2004). (Review)

  • P.T. Liu, S. Stenger, H. Li, L.Wenzel, B.H. Tan, S.R. Krutzik, M.T. Ochoa, J. Schauber, K. Wu, C. Meinken, D.L. Kamen, M. Wagner, R. Bals, A. Steinmeyer, U. Zügel, R.L. Gallo, D. Eisenberg, M. Hewison, B.W. Hollis, J.S. Adams, B.R. Bloom, and R., Science, 311, 1770 (2006). (Pharmacol.)

  • P.Y. Ong, T. Ohtake, C. Brandt, I. Strickland, M. Boguniewicz, T. Ganz, R.L. Gallo, and, D.Y.M. Leung, N. Engl. J. Med., 347, 1151 (2002). (Pharmacol.)

  • D.W. Hoskin and A. Ramamoorthy, Biochim. Biophys. Acta, 1778, 357 (2008). (LL-37 Review)

  • Y. Lai and R.L. Gallo, Trends Immunol., 30, 131 (2009). (Review)

  • M.F. Burton and P.G. Steel, Nat. Prod. Rep., 26, 1572 (2009). (Review)

  • 1ea
  • $150.00