Plectasin (0.1mg vial)

  • Hydrochloride Form
  • Product Code: PDF-4432-s
  • Synonyms/Product Alternate Names: Gly-Phe-Gly-Cys-Asn-Gly-Pro-Trp-Asp-Glu-Asp-Asp-Met-Gln-Cys-His-Asn-His-Cys-Lys-Ser-Ile-Lys-Gly-Tyr-Lys-Gly-Gly-Tyr-Cys-Ala-Lys-Gly-Gly-Phe-Val-Cys-Lys-Cys-Tyr
  • Antimicrobial Peptide
  • Origin: (Fungus, Pseudoplectania nigrella)
  • Storage Conditions: -20 °C
  • Molecular Weight: 4401.9
  • Molecular Formula: C189H267N53O56S7
  • Disulfide Bonds: (Disulfide bonds between Cys4-Cys30, Cys15-Cys37, and Cys19-Cys39)
  • One-Letter Code:
    GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
  • P.H. Mygind, et al., Nature, 437, 975 (2005). (Original ; Structure & Antimicrobial Activity)

  • S. Hara, et al., Biochem. Biophys. Res. Commun., 374, 709 (2008). (Pharmacol.)

  • K. Mandal, et al., Protein Sci., 18, 1146 (2009). (X-ray Structure)

  • T. Schneider, et al., Science, 328, 1168 (2010). (Pharmacol.)

  • 1ea
  • $295.00