ß-Defensin-3 (Human) (0.1mg vial)

  • Product Code: PDF-4382-s
  • Synonyms/Product Alternate Names: hBD-3, Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys, beta-Defensin-3, DEFB3
  • Antimicrobial Peptide / Staphylococcus aureus-Killing Factor
  • Storage Conditions: -20 °C
  • Molecular Weight: 5155.1
  • Molecular Formula: C216H371N75O59S6
  • Disulfide Bonds: (Disulfide bonds between Cys11-Cys40, Cys18-Cys33, and Cys23-Cys41)
  • One-Letter Code:
    GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
  • J. Harder, J. Bartels, E. Christophers, and J.-M. Schröder, J. Biol. Chem., 276, 5707 (2001). (Original)

  • J.-R.C. García, F. Jaumann, S. Schulz, A. Krause, J. Rodrínguez-Jiménez, U. Forssmann, K. Adermann, E. Klüver, C. Vogelmeier, D. Becker, R. Hedrich, W.-G. Forssmann, and R. Bals, Cell Tissue Res., 306, 257 (2001). (Original; Amino-Terminally Truncated Peptide)

  • L.A. Duits, M. Rademaker, B. Ravensbergen, M.A.J.A. van Sterkenburg, E. van Strijen, P.S. Hiemstra, and P.H. Nibbering, Biochem. Biophys. Res. Commun., 280, 522 (2001). (Pharmacol.)

  • H.P. Jia, B.C. Schutte, A. Schudy, R. Linzmeier, J.M. Guthmiller, G.K. Johnson, B.F. Tack, J.P. Mitros, A. Rosenthal, T. Ganz, and P.B. McCray, Jr., Gene, 263, 211 (2001). (DNA Seq/Tissue Distribution)

  • D.J. Schibli, H.N. Hunter, V. Aseyev, T.D. Starner, J.M. Wiencek, P.B. McCray, Jr., B.F. Tack, and H.J. Vogel, J. Biol. Chem., 277, 8279 (2002). (Solution Structure)

  • R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review)

  • 1ea
  • $311.00