ß-Defensin-2 (Human) (0.1mg vial)

  • Product Code: PDF-4338-s
  • Synonyms/Product Alternate Names: hBD-2, Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro
  • Antibacterial Peptide Specific for Gram-Negative Bacteria / Also Effective for Candida albicans
  • Storage Conditions: -20 °C
  • Molecular Weight: 4328.2
  • Molecular Formula: C188H305N55O50S6
  • Disulfide Bonds: (Disulfide bonds between Cys8-Cys37, Cys15-Cys28, and Cys20-Cys38)
  • One-Letter Code:
    GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • J. Harder, J. Bartels, E. Christophers, and J.-M. Schroder, Nature, 387, 861 (1997). (Original)

  • T. Hiratsuka, M. Nakazato, Y. Date, J. Ashitani, T. Minematsu, N. Chino, and S. Matsukura, Biochem. Biophys. Res. Commun., 249, 943 (1998). (Pharmacol.)

  • D.M. Hoover, K.R. Rajashankar, R. Blumenthal, A. Puri, J.J. Oppenheim, O. Chertov, and J. Lubkowski, J. Biol. Chem., 275, 32911 (2000). (S-S Bond)

  • T. Hiratsuka, H. Mukae, H. Iiboshi, J. Ashitani, K. Nabeshima, T. Minematsu, N. Chino, T. Ihi, S. Kohno, and M. Nakazato, Thorax, 58, 425 (2003). (Pharmacol.; Activity against Pseudomonas aeruginosa)

  • R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review)

  • 1ea
  • $300.00