ß-Defensin-1 (Human) (0.1mg vial)

  • Product Code: PDF-4337-s
  • Synonyms/Product Alternate Names: hBD-1, Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys, DEFB1, beta-Defensin-1
  • Antimicrobial Peptide
  • Storage Conditions: -20 °C
  • Molecular Weight: 3928.5
  • Molecular Formula: C167H256N48O50S6
  • Disulfide Bonds: (Disulfide bonds between Cys5-Cys34, Cys12-Cys27, and Cys17-Cys35)
  • One-Letter Code:
    DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • K.W. Bensch, M. Raida, H-J. Mägert, P. Schulz-Knappe, and W.-G. Forssmann, FEBS Lett., 368, 331 (1995). (Original)

  • M.J. Goldman, G.M. Anderson, E.D. Stolzenberg, U.P. Kari, M. Zasloff, and J.M. Wilson, Cell, 88, 553 (1997). (Pharmacol.; Inactivated in Cystic Fibrosis)

  • T. Hiratsuka, M. Nakazato, T. Ihi, T. Minematsu, N. Chino, T. Nakanishi, A. Shimizu, K. Kangawa, and S. Matsukura, Nephron, 85, 34 (2000). (Pharmacol.)

  • R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review)

  • 1ea
  • $279.00