α-Defensin-1 (Human) (0.1mg vial)

  • Product Code: PDF-4271-s
  • Synonyms/Product Alternate Names: Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys HNP-1 (HNP: Human Neutrophil Peptide), HNP-1, DEFA1, alpha-Defensin-1
  • Antimicrobial Peptide / Chemoattractant for Monocytes
  • Storage Conditions: -20 °C
  • Molecular Weight: 3442
  • Molecular Formula: C150H222N44O38S6
  • Disulfide Bonds: (Disulfide bonds are formed between Cys2-Cys30, Cys4-Cys19, and Cys9-Cys29)
  • One-Letter Code:
    ACYCRIPACIAGERRYGTCIYQGRLWAFCC
  • T. Ganz, M.E. Selsted, D. Szklarek, S.S.L. Harwig, K. Daher, D.F. Bainton, and R.I. Lehrer, J. Clin. Invest., 76, 1427 (1985). (Original; Isolation)

  • M.E. Selsted, S.S.L. Harwig, T. Ganz, J.W. Schilling, and R.I. Lehrer, J. Clin. Invest., 76, 1436 (1985). (Original; Structure)

  • R.I. Lehrer and T. Ganz, Ann. N.Y. Acad. Sci., 797, 228 (1996). (Review)

  • 1ea
  • $200.00