Echistatin

  • Trifluoroacetate Salt
  • Product Code: ECT-3760-PI
  • Synonyms/Product Alternate Names: H-Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Cys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr-OH
  • αVß3 Integrin Antagonist
  • A disintegrin, whose sequence is derived from the venom of the viper, Echis carinatus.  It is an inhibitor of both integrin-dependent cell adhesion and platelet aggregation, preventing blood coagulation. Echistatin also contains the Arg-Gly-Asp (RGD) sequence.

  • Storage Conditions: -20 °C
  • Molecular Weight: 5417.14
  • Molecular Formula: C217H341N71O74S9
  • Disulfide Bonds: Cys2-Cys11, Cys7-Cys32, Cys8-Cys37, and Cys20-Cys39
  • CAS Number: 154303-05-6
  • One-Letter Code:
    H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGCTCDCPRNPHKGPAT-OH
  • J. Musial, et al., Circulation, 82, 261 (1990).

  • M. Sato, et al., J. Cell.Biol., 111, 1713 (1990).

  • C.C. Kumar, et al., J. Pharmacol.Exp.Ther., 283, 843 (1997).

  • V. Garsky, et al., Proc Nat Acad of Sciences, 86, 4022 (1989).

  • 1mg
  • $1,200.00
  • 5mg
  • $4,800.00