PHM-27 (Human) (0.5 mg vial)

  • Product Code: PPM-4177-v
  • Synonyms/Product Alternate Names: His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH2, Peptide Histidine-Methionine
  • A potent agonist of the calcitonin receptor CALCR

  • Storage Conditions: -20 °C
  • Molecular Weight: 2985.4
  • Molecular Formula: C135H214N34O40S
  • CAS Number: 87403-73-4
  • One-Letter Code:
    HADGVFTSDFSKLLGQLSAKKYLESLM-NH2
  • N. Itoh, K. Obata, N. Yanaihara, and H. Okamoto, Nature, 304, 547 (1983). (Original)

  • 1ea
  • $428.00