PACAP27 (Human, 1-27 Amide) (0.5 mg vial)

  • Product Code: PPA-4231-v
  • Synonyms/Product Alternate Names: His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2, Pituitary Adenylate Cyclase Activating Polypeptide 27 (Human,Ovine, Rat, 1-27 Amide), PACAP-27
  • Pituitary Adenylate Cyclase Activating Polypeptide 27 (Human, 1-27 Amide)
  • Storage Conditions: -20 °C
  • Molecular Weight: 3147.6
  • Molecular Formula: C142H224N40O39S
  • CAS Number: 127317-03-7
  • One-Letter Code:
    HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
  • A. Miyata, L. Jiang, R.D. Dahl, C. Kitada, K. Kubo, M. Fujino, N. Minamino, and A. Arimura, Biochem. Biophys. Res. Commun., 170, 643 (1990). (Original)

  • C. Kimura, S. Ohkubo, K. Ogi, M. Hosoya, Y. Itoh, H. Onda, A. Miyata, L. Jiang, R.R. Dahl, H.H. Stibbs, A. Arimura, and M. Fujino, Biochem. Biophys. Res. Commun., 166, 81 (1990). (Original; Human and Bovine cDNA)

  • K. Ogi, C. Kimura, H. Onda, A. Arimura, and M. Fujino, Biochem. Biophys. Res. Commun., 173, 1271 (1990). (Original: Rat cDNA)

  • 1ea
  • $279.00