Amyloid ß-Protein (Human, 1-40) (HCl Form) (0.5 mg vial)

  • (Hydrochloride Form)
  • Product Code: PAB-4379-v
  • Synonyms/Product Alternate Names: Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
  • Specific Form Easily Transferrable to ß-Structure
  • Storage Conditions: -20 °C
  • Molecular Weight: 4329.89
  • Molecular Formula: C194H295N53O58S
  • CAS Number: 131438-79-4
  • One-Letter Code:
    DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
  • I. Kaneko, N. Yamada, Y. Sakuraba, M. Kamenosono, and S. Tutumi, J. Neurochem., 65, 2585 (1995). (Original)

  • I. Kaneko, S. Tutumi, J. Neurochem., 68, 438 (1997). (Facile β-Structure Formation)

  • 1ea
  • $268.00