Glucagon-like Peptide 2 (Human) (0.5 mg vial)

  • Product Code: PGL-4376-v
  • Synonyms/Product Alternate Names: H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-H-Thr-Lys-Ile-Thr-Asp-OH, GLP-2 (human)
  • Storage Conditions: -20 °C
  • Molecular Weight: 3766.1
  • Molecular Formula: C165H254N44O55S
  • CAS Number: 223460-79-5
  • One-Letter Code:
    HADGSFSDEMNTILDNLAARDFINWLIQTKITD
  • D.J. Drucker, Gut, 50, 4289 (2002). (Review) B. Hartmann, A.H. Johnsen, C. Ørskov, K. Adelhorst, L. Thim, and J.J. Holst, Peptides, 21, 73 (2000). (Pharmacol.)

  • M. Tang-Christensen, P.J. Larsen, J. Thulesen, J. Rømer, and N. Vrang, Nat. Med., 6, 802 (2000). (Pharmacol.)

  • E. Blázquez, E. Alvarez, M. Navarro, I. Roncero, F. Rodríguez-Fonseca, J.A. Chowen, and J.A. Zueco, Mol. Neurobiol., 18, 157 (1998). (Review)

  • G. van Dijk and T.E. Thiele, Neuropeptides, 33, 406 (1999). (Review

  • D.J. Drucker, Gut, 50, 428 (2002). (Review)

  • 1ea
  • $396.00