Glucagon-like Peptide 1 (Human, 7-36 Amide) (0.5 mg vial)

  • Product Code: PGL-4344-v
  • Synonyms/Product Alternate Names: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; GLP-1 (Human,(Bovine, Canine, Rat, Guinea pig, 7-36 Amide)
  • Storage Conditions: -20 °C
  • Molecular Weight: 3297.6
  • Molecular Formula: C149H226N40O45
  • CAS Number: 107444-51-9
  • One-Letter Code:
    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
  • M.D. Turton, D. O'shea, I. Gunn, S.A. Beak, C.M.B. Edwards, K. Meeran, S.J. Choi, G.M. Taylor, M.M. Heath, P.D. Lambert, J.P.H. Wilding, D.M. Smith, M.A. Ghatei,J. Herbert, and S.R. Bloom, Nature, 379, 69 (1996). (Orginial-CNS Effect on Feeding)

  • M. Tang-Christensen, P.J. Larsen, R. Göke, A. Fink-Jensen, D.S. Jessop, M. Møller, and S.P. Sheikh, Am. J. Physiol., 271, R848 (1996). (Original, CNS Effect on Drinking

  • E. Blázquez, E. Alvarez, M. Navarro, I. Roncero, F. Rodríguez-Fonseca, J.A. Chowen, and J.A. Zueco, Mol. Neurobiol., 18, 157 (1998). (Review)

  • G. van Dijk and T.E. Thiele, Neuropeptides, 33, 406 (1999). (Review

  • D.J. Drucker, Gut, 50, 428 (2002). (Review)

  • M.D. Turton, D. O'shea, I. Gunn, S.A. Beak, C.M.B. Edwards, K. Meeran, S.J. Choi, G.M. Taylor, M.M. Heath, P.D. Lambert, J.P.H. Wilding, D.M. Smith, M.A. Ghatei,J. Herbert, and S.R. Bloom, Nature, 379, 69 (1996). (Orginial-CNS Effect on Feeding)

  • G. van Dijk, T.E. Thiele, R.J. Seeley, S.C. Woods, and I.L. Bernstein, Nature, 385, 214 (1997). (Correspondence)

  • 1ea
  • $375.00