Glucagon-like Peptide 1 (Human 7-37) (0.5 mg vial)

  • Product Code: PGP-4280-v
  • Synonyms/Product Alternate Names: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly; GLP-1 (7-37) (Human, Bovine, Canine, Rat, Guinea pig)
  • Storage Conditions: -20 °C
  • Molecular Weight: 3355.7
  • Molecular Formula: C151H228N40O47
  • CAS Number: 106612-94-6
  • One-Letter Code:
    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
  • G.G. Holz IV, W.M. Kühtreiber, and J.F. Habener, Nature, 361, 362 (1993). (Original)

  • E. Blázquez, E. Alvarez, M. Navarro, I. Roncero, F. Rodríguez-Fonseca, J.A. Chowen, and J.A. Zueco, Mol. Neurobiol., 18, 157 (1998). (Review)

  • G. van Dijk and T.E. Thiele, Neuropeptides, 33, 406 (1999). (Review

  • D.J. Drucker, Gut, 50, 428 (2002). (Review)

  • 1ea
  • $375.00