Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)

  • Trifluoroacetate
  • Product Code: PGL-3826-PI
  • Synonyms/Product Alternate Names: Preproglucagon (53-89), Proglucagon (33-69), OXM, H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-OH
  • Inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans.
  • Storage Conditions: -20 °C
  • Molecular Weight: 4449.93
  • Molecular Formula: C192H295N61O60S
  • CAS Number: 159002-68-3
  • One-Letter Code:
    HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
  • 1mg
  • $642.00
  • 5mg
  • $2,568.00