CoV-2-2019 Nucleocapsid

  • Product Code: SARS-013
  • Synonyms/Product Alternate Names: Coronavirus 2019 Nucleocapsid Recombinant, CoV-2019 Nucleocapsid, SARS-CoV-2 Nucleocapsid
  • Please allow 2-3 weeks average availability

    A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV (COVID-19) was found in the city of Wuhan, Hubei province of China on December 2019.

    The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV (SARS-CoV-2) has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity, thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.

    RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus.

    The E. coli derived recombinant protein contains the Coronavirus 2019 full-length nucleoprotein: Gene bank- MN908947, fused to His tag at C-terminal and having a M.W. Of 48 kDa as appears on SDS-PAGE.

    Formulation: CoV 2019 protein solution is supplied in 25mM Tris base and 10mM K2CO3.

    Stability: CoV 2019 Nucleocapsid protein is shipped on ice packs. Upon arrival, Store at -20°C.

     Find other coronavirus products and news here.

  • Storage Conditions: -20 ℃
  • Purity: >95% pure as determined SDS-PAGE.
  • One-Letter Code:
    MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKED LKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGAN KDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSR SRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAA EASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFF GMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADE TQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Delivery Details: All quantities are subject to availability. Please allow 7-10 days for delivery.

  • 50µg
  • $150.00
  • 250µg
  • $600.00
  • 1000µg
  • $1,600.00
For research use ONLY. Not for use on humans.