IL 23 Human, His

  • Product Code: CYT-067
  • Synonyms/Product Alternate Names: Interleukin-23 Human Recombinant, His TagInterleukin 23 α subunit p19, Interleukin-12 subunit beta p40, SGRF, IL23P19, IL-23-A, interleukin-six, G-CSF related factor, JKA3 induced upon T-cell activation, interleukin 12B (natural killer cell stimulatory factor 2 cytotoxic lymphocyte maturation factor 2 p40), NK cell stimulatory factor chain 2, Cytotoxic lymphocyte maturation factor 40 kDa subunit, CLMF2, CLMF p40.
  • Origin: HEK 293 cells.
  • Storage Conditions: -20 °C
  • Purity: Greater than 90.0% as determined by analysis by SDS-PAGE.
  • One-Letter Code:
    IL23A-His:RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCG DGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLS QLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP HHHHHHHH
Delivery Details:
Close

All quantities are subject to availability. Please allow 7-10 days for delivery.

  • 2µg
  • $50.00
  • 10µg
  • $130.00
  • 100µg
  • $1,200.00