GIP (Human) (0.5 mg vial)

  • Product Code: PGR-4178-v
  • Synonyms/Product Alternate Names: Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; Gastric Inhibitory Polypeptide (Human) Glucose-dependent Insulinotropia Polypeptide (Human)
  • Storage Conditions: -20 °C
  • Molecular Weight: 4983.5
  • Molecular Formula: C226H338N60O66S
  • CAS Number: 100040-31-1
  • One-Letter Code:
    YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
  • A.J. Moody, L. Thim, and I. Valverde, FEBS Lett., 172, 142 (1984). (Original)

  • N. Fujii, M. Sakurai, K. Akaji, M. Nomizu, H. Yajima, K. Mizuta, M. Aono, M. Moriga, K. Inoue, R. Hosotani, and T. Tobe, Chem. Pharm. Bull., 34, 2397 (1986). (Glucose-dependent Insulinotropic Polypeptide)

  • J.E. Jorpes and V. Mutt (eds.) Secretin, Cholecystokinin, Pancreozymin and Gastrin, Handbook of Experimental Pharmacology, Vol. 34, Springer-Verlag, Berlin, 1973. (Review)

  • 5ea
  • $525.00